C-peptide is a bioactive peptide
نویسندگان
چکیده
منابع مشابه
Bioactive Peptide Discovery Platform
Food-protein derived bioactive peptides are short amino acid chains that are inactive within the sequence of the parent protein, but can be released through hydrolysis by proteolytic enzymes. Several physiological effects have been attributed to these peptides, such as blood pressure reduction, scavenging of oxidative compounds, induction of satiety and reduction of cholesterol. Due to their ab...
متن کاملA bioactive peptide amidating enzyme is required for ciliogenesis
The pathways controlling cilium biogenesis in different cell types have not been fully elucidated. We recently identified peptidylglycine α-amidating monooxygenase (PAM), an enzyme required for generating amidated bioactive signaling peptides, in Chlamydomonas and mammalian cilia. Here, we show that PAM is required for the normal assembly of motile and primary cilia in Chlamydomonas, planaria a...
متن کاملA novel bioactive peptide from wasp venom
Wasp venoms contain a number of pharmacologically active biomolecules, undertaking a wide range of functions necessary for the wasp's survival. We purified and characterized a novel bioactive peptide (vespin) from the venoms of Vespa magnifica (Smith) wasps with unique primary structure. Its amino acid sequence was determined to be CYQRRVAITAGGLKHRLMSSLIIIIIIRINYLRDNSVIILESSY. It has 44 residue...
متن کاملPeptide and Protein Delivery at a Glance
Peptide and protein drugs have found an important position in therapeutics. Recent advances in pharmaceutical biotechnology have led to an increase in the number of protein products in the market. As these therapeutic proteins and peptides are made available, it will be essential to formulate these drugs into safe and effective delivery systems. The twenty different naturally occurring amin...
متن کاملذخیره در منابع من
با ذخیره ی این منبع در منابع من، دسترسی به آن را برای استفاده های بعدی آسان تر کنید
ژورنال
عنوان ژورنال: Diabetologia
سال: 2007
ISSN: 0012-186X,1432-0428
DOI: 10.1007/s00125-006-0559-y